hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20090618/iprscan-20090618-17293062/chunk_1/iprscan-20090618-17293062.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: pj00267 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF08620.1.fs RPAP1-like, C-terminal 136.4 4.9e-39 1 PF08620.1.ls RPAP1-like, C-terminal 138.3 1.9e-38 1 PF08621.1.fs RPAP1-like, N-terminal 86.5 1.8e-24 1 PF08621.1.ls RPAP1-like, N-terminal 88.5 1.9e-23 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF08621.1.fs 1/1 246 294 .. 1 49 [] 86.5 1.8e-24 PF08621.1.ls 1/1 246 294 .. 1 49 [] 88.5 1.9e-23 PF08620.1.fs 1/1 376 447 .. 1 80 [] 136.4 4.9e-39 PF08620.1.ls 1/1 376 447 .. 1 80 [] 138.3 1.9e-38 Alignments of top-scoring domains: PF08621.1.fs: domain 1 of 1, from 246 to 294: score 86.5, E = 1.8e-24 *->aqrIheENlkkLqsMSpeEIeqEqeELlesLDPkLlemLkkRankke aq IheEN+++Lq M peEI+qEq++Ll++LDP+L+++L++++ ++e pj00267 246 AQTIHEENIARLQAMAPEEILQEQQRLLAQLDPSLVAFLRSHSHTQE 292 ks<-* ++ pj00267 293 QT 294 PF08621.1.ls: domain 1 of 1, from 246 to 294: score 88.5, E = 1.9e-23 *->aqrIheENlkkLqsMSpeEIeqEqeELlesLDPkLlemLkkRankke aq IheEN+++Lq M peEI+qEq++Ll++LDP+L+++L++++ ++e pj00267 246 AQTIHEENIARLQAMAPEEILQEQQRLLAQLDPSLVAFLRSHSHTQE 292 ks<-* ++ pj00267 293 QT 294 PF08620.1.fs: domain 1 of 1, from 376 to 447: score 136.4, E = 4.9e-39 *->lselRFDFkGelippsesledeKedipthlGLHHHGEepeaAGYTlp +++RF+++Gel+ p++ d+pthlGLHHHGEe+e+AGY+l+ pj00267 376 RMQARFSLQGELLAPDV-------DLPTHLGLHHHGEEAERAGYSLQ 415 ELlhLsRSsvpsQRciAlqtLgrIlyrlgakge<-* EL+hL RS+v +QR +Al++L+++++r++ +ge pj00267 416 ELFHLTRSQVSQQRALALHVLAQVISRAQ-AGE 447 PF08620.1.ls: domain 1 of 1, from 376 to 447: score 138.3, E = 1.9e-38 *->lselRFDFkGelippsesledeKedipthlGLHHHGEepeaAGYTlp +++RF+++Gel+ p++ d+pthlGLHHHGEe+e+AGY+l+ pj00267 376 RMQARFSLQGELLAPDV-------DLPTHLGLHHHGEEAERAGYSLQ 415 ELlhLsRSsvpsQRciAlqtLgrIlyrlgakge<-* EL+hL RS+v +QR +Al++L+++++r++ +ge pj00267 416 ELFHLTRSQVSQQRALALHVLAQVISRAQ-AGE 447 //