hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080813/iprscan-20080813-12565531/chunk_1/iprscan-20080813-12565531.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: pj00587 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF00076.12.fs RNA recognition motif. (a.k.a. RRM, RBD, or 78.1 3.9e-21 1 PF00076.12.ls RNA recognition motif. (a.k.a. RRM, RBD, or 80.0 6.8e-21 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF00076.12.fs 1/1 222 293 .. 1 74 [] 78.1 3.9e-21 PF00076.12.ls 1/1 222 293 .. 1 74 [] 80.0 6.8e-21 Alignments of top-scoring domains: PF00076.12.fs: domain 1 of 1, from 222 to 293: score 78.1, E = 3.9e-21 *->lfVgNLppdtteedLkdlFskfGpiesikivrDttretgrskGfaFV lf+ Lp++ +++L + F +fG ++s+k++ D r+t++sk f+FV pj00587 222 LFIYHLPQEFGDAELIQTFLPFGAVVSAKVFVD--RATNQSKCFGFV 266 eFedeedAekAldalnGkelggrelrv<-* F+++ +A+ A++a+nG+++g ++l+v pj00587 267 SFDNPTSAQTAIQAMNGFQIGMKRLKV 293 PF00076.12.ls: domain 1 of 1, from 222 to 293: score 80.0, E = 6.8e-21 *->lfVgNLppdtteedLkdlFskfGpiesikivrDttretgrskGfaFV lf+ Lp++ +++L + F +fG ++s+k++ D r+t++sk f+FV pj00587 222 LFIYHLPQEFGDAELIQTFLPFGAVVSAKVFVD--RATNQSKCFGFV 266 eFedeedAekAldalnGkelggrelrv<-* F+++ +A+ A++a+nG+++g ++l+v pj00587 267 SFDNPTSAQTAIQAMNGFQIGMKRLKV 293 //