hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080813/iprscan-20080813-13023100/chunk_1/iprscan-20080813-13023100.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: pj00650 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00273 225.0 6.6e-63 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00273 1/1 51 177 .. 1 137 [] 225.0 6.6e-63 Alignments of top-scoring domains: SM00273: domain 1 of 1, from 51 to 177: score 225.0, E = 6.6e-63 *->sdlevkVrkATnndewgpkgkhlreIlqgTsneklrssfaeimavlw s++e+kVr+AT+nd+wgp +++++eI+++T n+ ++f+e+m +lw pj00650 51 SEAEIKVREATSNDPWGPPSSLMSEIADLTFNT---VAFTEVMGMLW 94 rRLndkgknWrvvyKaLillhyLlrnGspfervvlealrnrnrIltLsdf rRLnd+gknWr+vyKaL+ll+yLl+ Gs erv +++++n ++I+tL+df pj00650 95 RRLNDSGKNWRHVYKALTLLDYLLKTGS--ERVAHQCRENLYTIQTLKDF 142 qdkvfndidsrgkDqGaniRtyakyLlelledderlkeer<-* q+ id++gkDqG n+R+++k++++ll+d+erl++er pj00650 143 QY-----IDRDGKDQGVNVREKVKQVMALLKDEERLRQER 177 //