hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080813/iprscan-20080813-15493443/chunk_1/iprscan-20080813-15493443.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: sh00386 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF00173.18.ls Cytochrome b5-like Heme/Steroid binding doma 85.1 2e-22 1 PF00173.18.fs Cytochrome b5-like Heme/Steroid binding doma 83.2 3.3e-22 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF00173.18.fs 1/1 32 106 .. 1 81 [] 83.2 3.3e-22 PF00173.18.ls 1/1 32 106 .. 1 81 [] 85.1 2e-22 Alignments of top-scoring domains: PF00173.18.fs: domain 1 of 1, from 32 to 106: score 83.2, E = 3.3e-22 *->yftleelkehdGkkdgrilvainGkVYDlsrflkfhPgGqsallafa y+tlee+++h+ ++ +++++ kVYDl++fl++hPgG+ +l+ a sh00386 32 YYTLEEIQKHN--HSKSTWLILHHKVYDLTKFLEEHPGGEEVLREQA 76 GrDaTraFaaklaahseeaaeellekyykvGrld<-* G+DaT+ F + hs ++a+e+ + + +G+l sh00386 77 GGDATENF--EDVGHS-TDAREMSKT-FIIGELH 106 PF00173.18.ls: domain 1 of 1, from 32 to 106: score 85.1, E = 2e-22 *->yftleelkehdGkkdgrilvainGkVYDlsrflkfhPgGqsallafa y+tlee+++h+ ++ +++++ kVYDl++fl++hPgG+ +l+ a sh00386 32 YYTLEEIQKHN--HSKSTWLILHHKVYDLTKFLEEHPGGEEVLREQA 76 GrDaTraFaaklaahseeaaeellekyykvGrld<-* G+DaT+ F + hs ++a+e+ + + +G+l sh00386 77 GGDATENF--EDVGHS-TDAREMSKT-FIIGELH 106 //