hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /db/iprscan/data/smart.HMMs.bin
Sequence file:            /db/iprscan/tmp/20080813/iprscan-20080813-16310264/chunk_1/iprscan-20080813-16310264.nocrc
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: sh02340
Accession:      [none]
Description:    [none]

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
SM00248                                                 162.2    5.2e-44   6
SM00454                                                 113.2      3e-29   2
SM00326                                                  37.0    2.6e-06   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
SM00248    1/6     172   201 ..     1    30 []    29.3  0.00052
SM00248    2/6     205   234 ..     1    30 []    25.8    0.006
SM00248    3/6     238   267 ..     1    30 []    30.4  0.00025
SM00248    4/6     271   300 ..     1    30 []    16.1      5.1
SM00248    5/6     312   341 ..     1    30 []    35.3  8.2e-06
SM00248    6/6     344   373 ..     1    30 []    25.3   0.0085
SM00326    1/1     408   470 ..     1    58 []    37.0  2.6e-06
SM00454    1/2     610   676 ..     1    67 []    54.5  1.4e-11
SM00454    2/2     679   746 ..     1    67 []    58.7  7.4e-13

Alignments of top-scoring domains:
SM00248: domain 1 of 6, from 172 to 201: score 29.3, E = 0.00052
                   *->dGrTpLHlAaengnlevvklLldkgadina<-*
                      dG+++LH+Aa  g+le++ lLl++ a++++   
     sh02340   172    DGFSALHHAALGGSLELIALLLEAQATVDI    201  

SM00248: domain 2 of 6, from 205 to 234: score 25.8, E = 0.006
                   *->dGrTpLHlAaengnlevvklLldkgadina<-*
                      +G+ pLH+Aa  g+le v+lLl+++a +na   
     sh02340   205    NGMRPLHYAAWQGRLEPVRLLLRASAAVNA    234  

SM00248: domain 3 of 6, from 238 to 267: score 30.4, E = 0.00025
                   *->dGrTpLHlAaengnlevvklLldkgadina<-*
                      dG+ pLHlAa++g++ev ++Ll++  ++ +   
     sh02340   238    DGQIPLHLAAQYGHYEVSEMLLQHQSNPCL    267  

SM00248: domain 4 of 6, from 271 to 300: score 16.1, E = 5.1
                   *->dGrTpLHlAaengnlevvklLldkgadina<-*
                        +TpL lA+e g+l+v++lLl++   + +   
     sh02340   271    AKKTPLDLACEFGRLKVAQLLLNSHLCVAL    300  

SM00248: domain 5 of 6, from 312 to 341: score 35.3, E = 8.2e-06
                   *->dGrTpLHlAaengnlevvklLldkgadina<-*
                      +  TpLHlAa+ng+ ev++ Ll++g +in    
     sh02340   312    NYTTPLHLAAKNGHREVIRQLLRAGIEINR    341  

SM00248: domain 6 of 6, from 344 to 373: score 25.3, E = 0.0085
                   *->dGrTpLHlAaengnlevvklLldkgadina<-*
                         T+LH Aa +g  evv+lLl+ g+d+n+   
     sh02340   344    KTGTALHEAALYGKTEVVRLLLEGGVDVNI    373  

SM00326: domain 1 of 1, from 408 to 470: score 37.0, E = 2.6e-06
                   *->eyvvAlYDyea.qnedELsFkkGDiitvleksddgWweGelnr....
                       +v+Al D+    ++  L +++GD+itvle++ dg w+G ++ ++++
     sh02340   408    LKVRALKDFWNlHDPTALNVRAGDVITVLEQHPDGRWKGHIHEsqrg 454  

                   tGkeGlfPsnYVeeie<-*
                   t ++G+fP   Ve++    
     sh02340   455 TDRIGYFPPGIVEVVS    470  

SM00454: domain 1 of 2, from 610 to 676: score 54.5, E = 1.4e-11
                   *->vs.wspesVaeWLesigleqYadnFrkngidgeelllltseedLkel
                       ++ +   + +WL   +le Y+ +F+++g+d     ++t  edL+ +
     sh02340   610    LEgKDAQAIHNWLSEFQLEGYTAHFLQAGYDVPTISRMT-PEDLTAI 655  

                   GitllGhRkkIlsaiqklkeq<-*
                   G+t++GhRkkI+s+i +l      
     sh02340   656 GVTKPGHRKKIASEIAQLSIA    676  

SM00454: domain 2 of 2, from 679 to 746: score 58.7, E = 7.4e-13
                   *->vs.wspesVaeWLesigleqYadnFrkngidgeelllltseedLkel
                       ++  p ++ eWL ++gl+qY +++ + g+d++ l++ ++ e L+e+
     sh02340   679    LPsYIPTDLLEWLCALGLPQYHKQLVSSGYDSMGLVADLTWEELQEI 725  

                   GitllGhRkkIlsaiqklkeq<-*
                   G+++lGh+kk++ +++ l e    
     sh02340   726 GVNKLGHQKKLMLGVKRLAEL    746  

//