hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /db/iprscan/data/Pfam.bin
Sequence file:            /db/iprscan/tmp/20090416/iprscan-20090416-18043564/chunk_1/iprscan-20090416-18043564.nocrc
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: sh02545
Accession:      [none]
Description:    [none]

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
PF00397.16.fs WW domain                                       38.3    9.2e-10   1
PF00397.16.ls WW domain                                       40.4    5.9e-09   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
PF00397.16.fs   1/1     154   183 ..     1    30 []    38.3  9.2e-10
PF00397.16.ls   1/1     154   183 ..     1    30 []    40.4  5.9e-09

Alignments of top-scoring domains:
PF00397.16.fs: domain 1 of 1, from 154 to 183: score 38.3, E = 9.2e-10
                   *->lppgWeertdpdGrpYYyNhnTktTqWekP<-*
                      +   W e+++++G++YYyN  T  +qWekP   
     sh02545   154    SADDWSEHISSSGKKYYYNCRTEVSQWEKP    183  

PF00397.16.ls: domain 1 of 1, from 154 to 183: score 40.4, E = 5.9e-09
                   *->lppgWeertdpdGrpYYyNhnTktTqWekP<-*
                      +   W e+++++G++YYyN  T  +qWekP   
     sh02545   154    SADDWSEHISSSGKKYYYNCRTEVSQWEKP    183  

//