hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /db/iprscan/data/smart.HMMs.bin
Sequence file:            /db/iprscan/tmp/20090416/iprscan-20090416-18043564/chunk_1/iprscan-20090416-18043564.nocrc
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: sh02545
Accession:      [none]
Description:    [none]

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
SM00456                                                  39.9    3.4e-07   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
SM00456    1/1     153   185 ..     1    34 []    39.9  3.4e-07

Alignments of top-scoring domains:
SM00456: domain 1 of 1, from 153 to 185: score 39.9, E = 3.4e-07
                   *->plPpgWeerkdpdsGrpYYyNheTketqWekPre<-*
                      ++ + W e+++ + G++YYyN  T  +qWekP e   
     sh02545   153    DSADDWSEHISSS-GKKYYYNCRTEVSQWEKPKE    185  

//