hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /db/iprscan/data/smart.HMMs.bin
Sequence file:            /db/iprscan/tmp/20090618/iprscan-20090618-17595139/chunk_1/iprscan-20090618-17595139.nocrc
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: sh03843
Accession:      [none]
Description:    [none]

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
SM00382                                                  72.1    7.1e-17   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
SM00382    1/1     496   679 ..     1    92 []    72.1  7.1e-17

Alignments of top-scoring domains:
SM00382: domain 1 of 1, from 496 to 679: score 72.1, E = 7.1e-17
                   *->pgevvllvGppGsGKTTlaralarllgp...gviyidge........
                      pgev++lvGp+GsGK+T+a++l +l++p+++ v++   + ++ ++  
     sh03843   496    PGEVTALVGPNGSGKSTVAALLQNLYQPtggQVLLDEKPisqyehcy 542  

                   ..................................................
                    +++  + +++    +++ +++   + ++ ++++     +  + ++  ++
     sh03843   543 lhsqvvsvgqepvlfsgsvrnniayglqsceddkvmaaaqaahaddfiqe 592  

                   ...................ggqrirlalalark.dvlllDEitslld...
                    +++   + ++++++   ++ qr+++a+al+r ++vl+lDE+ts+ld + 
     sh03843   593 mehgiytdvgekgsqlaagQKQRLAIARALVRDpRVLILDEATSALDvqc 642  

                   ............vtviattndldpallrrrfdrrivllril<-*
                   ++ +++ ++++++tv+++++  + a+ r    ++i +l+ +   
     sh03843   643 eqalqdwnsrgdRTVLVIAH-RLQAVQR---AHQILVLQEG    679  

//