hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080813/iprscan-20080813-17365614/chunk_1/iprscan-20080813-17365614.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: sh03965 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF00609.10.fs Diacylglycerol kinase accessory domain 104.3 2.9e-29 1 PF00609.10.ls Diacylglycerol kinase accessory domain 55.5 1.6e-13 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF00609.10.ls 1/1 3 121 .. 1 190 [] 55.5 1.6e-13 PF00609.10.fs 1/1 8 121 .. 45 190 .] 104.3 2.9e-29 Alignments of top-scoring domains: PF00609.10.ls: domain 1 of 1, from 3 to 121: score 55.5, E = 1.6e-13 *->iINNYFSiGVDAsialrFHimREknPekFnSRmkNKlwYfefGtset ++ + s++ sh03965 3 ---------------------------------------LRRAFSDF 10 lastcknLhesvelecdGqevdLsnrDaslEGIiiLNIPSygGGsnLWGe l+ ++k+L+++++++cdG +++ + +D+ + +++LNIP y G+ +WG sh03965 11 LMGSSKDLAKHIRVVCDGMDLTPKIQDLKPQCVVFLNIPRYCAGTMPWGH 60 skksrgrirefkksitdpkdlktavqdidDgLlEVVGlegamhmgqiyts + ++ q++dDg lEV+G + ++ + sh03965 61 ---P-------------GEHHDFEPQRHDDGYLEVIGFT-MTSLAAL--- 90 iqlglasWvkLmkGrRlaQCsevRlkDiiktektlPMQVDGEP<-* q+g + G Rl QC+ev ++ t+k++P+QVDGEP sh03965 91 -QVGGH-------GERLTQCREV----VLTTSKAIPVQVDGEP 121 PF00609.10.fs: domain 1 of 1, from 8 to 121: score 104.3, E = 2.9e-29 *->setlastcknLhesvelecdGqevdLsnrDaslEGIiiLNIPSygGG s++l+ ++k+L+++++++cdG +++ + +D+ + +++LNIP y G sh03965 8 SDFLMGSSKDLAKHIRVVCDGMDLTPKIQDLKPQCVVFLNIPRYCAG 54 snLWGeskksrgrirefkksitdpkdlktavqdidDgLlEVVGlegamhm + +WG + ++ q++dDg lEV+G + + sh03965 55 TMPWGH---P-------------GEHHDFEPQRHDDGYLEVIGFT-MTSL 87 gqiytsiqlglasWvkLmkGrRlaQCsevRlkDiiktektlPMQVDGEP< + + q+g + G Rl QC+ev ++ t+k++P+QVDGEP sh03965 88 AAL----QVGGH-------GERLTQCREV----VLTTSKAIPVQVDGEP 121 -* sh03965 - - //