hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080813/iprscan-20080813-18013375/chunk_1/iprscan-20080813-18013375.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: sh04870 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00115 -0.0 3.6e-08 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00115 1/1 1 139 [. 1 282 [] -0.0 3.6e-08 Alignments of top-scoring domains: SM00115: domain 1 of 1, from 1 to 139: score -0.0, E = 3.6e-08 *->iYrmnskprRtGlALIINNenFdsesgLkrRnGTdvDaenLtelFes ++ +s sh04870 1 ------EEV-------------TS----------------------- 5 LGYeVkvknnLtaeeMleelkefAelpeHsdsDSfvlVlLSHGeeggiyG l++l +f + sh04870 6 ----------------LSILSAFVT------------------------- 14 tDgsekkpvhdplkideIfslFngdnCpsLagKPKlFfIQACRGdeldgg D e+d+g sh04870 15 -D-------------------------------------------ETDRG 20 vpvedsvaeqpspksvesddargtetdsgtseeleddavydkipveADFl v+++d++++++sp+ +es +++++ +++++p+++D++ sh04870 21 VDQQDGKNHAGSPGCEES-------------DAGKEKLPKMRLPTRSDMI 57 aaySTtPgyvSwRnptrGSWFIqsLcevlkeyaksldlldiLteVnqkVa ++y++ +g++++Rn++rGSW+I++L +v++e+a++++++d+L++Vn ++ sh04870 58 CGYACLKGTAAMRNTKRGSWYIEALAQVFSERACDMHVADMLVKVNALIK 107 vkfesnqpddptsnakkQmPtitsmTLtKkLyffp<-* +++++ +++t++++++ + +++TL+++Ly+fp sh04870 108 DREGY---APGTEFHRCKEMSEYCSTLCRHLYLFP 139 //