hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080813/iprscan-20080813-18073891/chunk_1/iprscan-20080813-18073891.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: sh06345 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00326 142.2 5.5e-38 2 SM00666 49.1 5.7e-10 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00326 1/2 60 115 .. 1 58 [] 59.6 4e-13 SM00666 1/1 168 246 .. 1 95 [] 49.1 5.7e-10 SM00326 2/2 277 332 .. 1 58 [] 82.6 4.8e-20 Alignments of top-scoring domains: SM00326: domain 1 of 2, from 60 to 115: score 59.6, E = 4e-13 *->eyvvAlYDyeaqnedELsFkkGDiitvleksddgWweGelnrtGkeG e ++l+ + +++ +EL + +G i+ vl+k +d+W + n G++G sh06345 60 EAHRVLFGFVPETKEELQVMPGNIVFVLKKGNDNWATVMFN--GQKG 104 lfPsnYVeeie<-* l+P+nY+e++e sh06345 105 LVPCNYLEPVE 115 SM00666: domain 1 of 1, from 168 to 246: score 49.1, E = 5.7e-10 *->tvdvKlrYvggetrrlsvprdisfedLrskvakrfgldneqpftLKY ++++K++Y t++++ +++++++++r++v+k++ l e +++L+Y sh06345 168 PYTLKVHY--KYTVVMKTQPGLPYSQVRDMVSKKLELRLE-HTKLSY 211 qLPDeDgDalVsltsDeDLeeaieeydslesskkSsgsktlrllvfvs<- + D + ++ s++++++a+ +++ + +l l++ + sh06345 212 R--PRDSN-ELVPLSEDSMKDAWGQVK----------NYCLTLWCENT 246 * sh06345 - - SM00326: domain 2 of 2, from 277 to 332: score 82.6, E = 4.8e-20 *->eyvvAlYDyeaqnedELsFkkGDiitvleksddgWweGelnrtGkeG +v Al++yea+++++L F++GDii+vl+k++++W+eGe++ Gk+G sh06345 277 SQVEALFSYEATQPEDLEFQEGDIILVLSKVNEEWLEGECK--GKVG 321 lfPsnYVeeie<-* +fP+ +Ve + sh06345 322 IFPKVFVEDCA 332 //