hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080813/iprscan-20080813-19163208/chunk_1/iprscan-20080813-19163208.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: sj01267 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF00342.9.fs Phosphoglucose isomerase 63.5 5.7e-17 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF00342.9.fs 1/1 375 415 .. 1 41 [. 63.5 5.7e-17 Alignments of top-scoring domains: PF00342.9.fs: domain 1 of 1, from 375 to 415: score 63.5, E = 5.7e-17 *->DYSKnhiddeilsaLlkLaeeaklkaareamFnGekiNvTE<-* DYSKn+++++++++L++La++++++aare+mFnGekiN+TE sj01267 375 DYSKNLVTEDVMRMLVDLAKSRGVEAARERMFNGEKINYTE 415 //