hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080813/iprscan-20080813-20020862/chunk_1/iprscan-20080813-20020862.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: sj03455 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00255 155.1 7.1e-42 1 SM00369 107.1 2e-27 11 SM00082 58.1 1.1e-12 1 SM00365 26.2 0.0045 5 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00369 1/11 62 81 .. 1 24 [] 0.4 3.7e+02 SM00369 2/11 82 105 .. 1 24 [] 17.8 1.6 SM00369 3/11 106 129 .. 1 24 [] 21.9 0.09 SM00365 1/5 154 178 .. 1 22 [] 3.8 2.8e+02 SM00369 4/11 154 178 .. 1 24 [] 3.2 1.7e+02 SM00369 5/11 179 200 .. 1 24 [] 13.4 9.7 SM00365 2/5 179 200 .. 1 22 [] 14.9 12 SM00369 6/11 206 230 .. 1 24 [] 6.1 75 SM00369 7/11 377 398 .. 1 24 [] 5.8 81 SM00365 3/5 403 425 .. 1 22 [] 0.8 6.4e+02 SM00365 4/5 426 447 .. 1 22 [] 6.0 1.5e+02 SM00369 8/11 426 449 .. 1 24 [] 1.5 2.7e+02 SM00369 9/11 475 499 .. 1 24 [] 2.7 2e+02 SM00365 5/5 500 521 .. 1 22 [] 0.7 6.6e+02 SM00369 10/11 500 523 .. 1 24 [] 24.3 0.017 SM00369 11/11 524 545 .. 1 24 [] 10.1 24 SM00082 1/1 584 633 .. 1 55 [] 58.1 1.1e-12 SM00255 1/1 678 823 .. 1 147 [] 155.1 7.1e-42 Alignments of top-scoring domains: SM00369: domain 1 of 11, from 62 to 81: score 0.4, E = 3.7e+02 *->LpnLreLdLsnNqLtsLPpgaFqg<-* + LdLs+N L++L + F + sj03455 62 ----KNLDLSFNPLRHLGSYSFFS 81 SM00369: domain 2 of 11, from 82 to 105: score 17.8, E = 1.6 *->LpnLreLdLsnNqLtsLPpgaFqg<-* p+L++LdLs+ ++++ +ga q+ sj03455 82 FPELQVLDLSRCEIQTIEDGAYQS 105 SM00369: domain 3 of 11, from 106 to 129: score 21.9, E = 0.09 *->LpnLreLdLsnNqLtsLPpgaFqg<-* L++L +L L +N ++sL gaF+g sj03455 106 LSHLSTLILTGNPIQSLALGAFSG 129 SM00365: domain 1 of 5, from 154 to 178: score 3.8, E = 2.8e+02 *->LtnLeeLdLsqNkI...kkiENLde<-* L+ L+eL + +N+I++ k E ++ sj03455 154 LKTLKELNVAHNLIqsfKLPEYFSN 178 SM00369: domain 4 of 11, from 154 to 178: score 3.2, E = 1.7e+02 *->LpnLreLdLsnNqLtsLP.pgaFqg<-* L L+eL+ +N ++s p+ F++ sj03455 154 LKTLKELNVAHNLIQSFKlPEYFSN 178 SM00369: domain 5 of 11, from 179 to 200: score 13.4, E = 9.7 *->LpnLreLdLsnNqLtsLPpgaFqg<-* L+nL++LdLs+N+++s+ + sj03455 179 LTNLEHLDLSSNKIQSI--YCTDL 200 SM00365: domain 2 of 5, from 179 to 200: score 14.9, E = 12 *->LtnLeeLdLsqNkIkkiENLde<-* LtnLe+LdLs+NkI++i d sj03455 179 LTNLEHLDLSSNKIQSIYCTDL 200 SM00369: domain 6 of 11, from 206 to 230: score 6.1, E = 75 *->LpnL.reLdLsnNqLtsLPpgaFqg<-* +p L+ +LdLs N + pgaF sj03455 206 MPLLnLSLDLSLNPMNFIQPGAFKE 230 SM00369: domain 7 of 11, from 377 to 398: score 5.8, E = 81 *->LpnLreLdLsnNqLtsLPpgaFqg<-* Lp+L+ LdLs+N L+ g ++ sj03455 377 LPSLEFLDLSRNGLSF--KGCCSQ 398 SM00365: domain 3 of 5, from 403 to 425: score 0.8, E = 6.4e+02 *->LtnLeeLdLsqNkI.kkiENLde<-* t L++LdLs+N+ + +N + sj03455 403 TTSLKYLDLSFNGViTMSSNFLG 425 SM00365: domain 4 of 5, from 426 to 447: score 6.0, E = 1.5e+02 *->LtnLeeLdLsqNkIkkiENLde<-* L +Le+Ld+++ +k+++ + sj03455 426 LEQLEHLDFQHSNLKQMSEFSV 447 SM00369: domain 8 of 11, from 426 to 449: score 1.5, E = 2.7e+02 *->LpnLreLdLsnNqLtsLPpgaFqg<-* L +L++Ld ++ +L++ + sj03455 426 LEQLEHLDFQHSNLKQMSEFSVFL 449 SM00369: domain 9 of 11, from 475 to 499: score 2.7, E = 2e+02 *->LpnLreLdLsnNqL..tsLPpgaFqg<-* L++L++L +N +++ LP ++F sj03455 475 LSSLEVLKMAGNSFqeNFLP-DIFTE 499 SM00365: domain 5 of 5, from 500 to 521: score 0.7, E = 6.6e+02 *->LtnLeeLdLsqNkIkkiENLde<-* L nL+ LdLsq ++++++ sj03455 500 LRNLTFLDLSQCQLEQLSPTAF 521 SM00369: domain 10 of 11, from 500 to 523: score 24.3, E = 0.017 *->LpnLreLdLsnNqLtsLPpgaFqg<-* L+nL+ LdLs qL++L p aF++ sj03455 500 LRNLTFLDLSQCQLEQLSPTAFNS 523 SM00369: domain 11 of 11, from 524 to 545: score 10.1, E = 24 *->LpnLreLdLsnNqLtsLPpgaFqg<-* L++L++L+ s+N++ sL ++F sj03455 524 LSSLQVLNMSHNNFFSL--DTFPY 545 SM00082: domain 1 of 1, from 584 to 633: score 58.1, E = 1.1e-12 *->NPfnCDCeLrwLlrwleaqnnealqdpvsslrCasPeslrGqpllll N f+C+Ce++ +l+w+++ ++++l + + ++ Ca+P++ +G+p+l+l sj03455 584 NDFACTCEHQSFLQWIKD-QRQLLVEVE-RMECATPSDKQGMPVLSL 628 lpsefsCp<-* + +C+ sj03455 629 N---ITCQ 633 SM00255: domain 1 of 1, from 678 to 823: score 155.1, E = 7.1e-42 *->eydvFiSfrg.deedvrnefvshLlkalrgkgklcvFiDdfepgggd yd+F++++++de++vrne+v+ L+++ +++ +lc++++df+pg ++ sj03455 678 IYDAFVIYSSqDEDWVRNELVKNLEEGVPPF-QLCLHYRDFIPGVAI 723 aenkllpelfeaIekSriaivvlSpnYaeSeWCldlElvaalecale.gg a n +++e+ +kSr++ivv+S+++++S+WC + E ++a+ +++ + + sj03455 724 AAN----IIHEGFHKSRKVIVVVSQHFIQSRWCIF-EYEIAQTWQFLsSR 768 lrvIPIfyevi.sdvrkqtgkfgkvfkkngpedtylkwted......fWk +I I++ +++++ + q+ ++ ++ +n tyl+w + +++ fW+ sj03455 769 AGIIFIVLQKVeKTLLRQQVELYRLLSRN----TYLEWEDSvlgrhiFWR 814 kalysvpnk<-* ++++++ + sj03455 815 RLRKALLDG 823 //